Structure of PDB 7nhm Chain 9

Receptor sequence
>7nhm9 (length=36) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQ
3D structure
PDB7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chain9
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 9 M1 K2 R4 P5 S6 V7 K8 R19 K20 P30 K31 K33 R35 Q36 M1 K2 R4 P5 S6 V7 K8 R19 K20 P30 K31 K33 R35 Q36
BS02 ZN 9 C27 H32 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum7nhm
PubMed34117249
UniProtQ2FW29|RL36_STAA8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]