Structure of PDB 7bl5 Chain 9

Receptor sequence

>7bl59 (length=338) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence]

MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDVWMEAD
ENLNTLIDYRFEKSFRAERGQNGASRDCTGKRGKDVTIKVPVGTRVIDQG
TGETMGDMTKHGQRLLVAKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKR
ELLLELMLLADVGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGV
VRMDNEKSFVVADIPGLIEGAAEGAGLGIRFLKHLERCRVLLHLIDIDPI
DGTDPVENARIIISELEKYSQDLATKPRWLVFNKIDLLDKVEAEEKAKAI
AEALGWEDKYYLISAASGLGVKDLCWDVMTFIIENPVV

3D structure

PDB

7bl5 Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	9	M1 R25 E26 K27 Y28 P30 K31 G32 G33 P34 E51 N52 I57 D58 R60 F61 R76 D77 C78 T79 K81 W122 H123 L125 R129 F130 K131 S132 S133 V134 R136 T137 A181 A182 Y189 F191 L198 V200 R202 A225 G226	M1 R25 E26 K27 Y28 P30 K31 G32 G33 P34 E51 N52 I57 D58 R60 F61 R76 D77 C78 T79 K81 W122 H123 L125 R129 F130 K131 S132 S133 V134 R136 T137 A181 A182 Y189 F191 L198 V200 R202 A225 G226
BS02	GDP	9	P168 N169 A170 G171 K172 T174 A187 D188 T192 N283 K284 D286 A316	P168 N169 A170 G171 K172 T174 A187 D188 T192 N283 K284 D286 A316
BS03	MG	9	K172 S173	K172 S173

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003677	DNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0017111	ribonucleoside triphosphate phosphatase activity
GO:0019003	GDP binding
GO:0019843	rRNA binding
GO:0032561	guanyl ribonucleotide binding
GO:0043023	ribosomal large subunit binding
GO:0046872	metal ion binding
GO:0097216	guanosine tetraphosphate binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0007059	chromosome segregation
GO:0022611	dormancy process
GO:0042254	ribosome biogenesis
GO:0042255	ribosome assembly
GO:0090071	negative regulation of ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bl5, PDBe:7bl5, PDBj:7bl5
PDBsum	7bl5
PubMed	33639093
UniProt	P42641\|OBG_ECOLI GTPase ObgE/CgtA (Gene Name=obgE)

[Back to BioLiP]