Structure of PDB 6q8o Chain 9

Receptor sequence
>6q8o9 (length=180) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLE
KCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFC
GLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAK
RTGKPVKVGYVVPYVRPELEGFKAPTEGGK
3D structure
PDB6q8o Key role of quinone in the mechanism of respiratory complex I.
Chain9
Resolution3.605 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 9 H41 C63 P64 I68 C98 I99 F100 C101 C104 H40 C62 P63 I67 C97 I98 F99 C100 C103
BS02 SF4 9 C53 I54 G55 C56 C59 Y91 C108 P109 T110 A112 I113 C52 I53 G54 C55 C58 Y90 C107 P108 T109 A111 I112
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q8o, PDBe:6q8o, PDBj:6q8o
PDBsum6q8o
PubMed32811817
UniProtQ56224|NQO9_THET8 NADH-quinone oxidoreductase subunit 9 (Gene Name=nqo9)

[Back to BioLiP]