Structure of PDB 6ijo Chain 9

Receptor sequence

>6ijo9 (length=172) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

PTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRWAM
MAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKRYQ
GFKQTGTSGFINSAGMNSPSMATKEVKNGRLAMVAFIGFCVQALATRTQP
IEGLTAHLADPFGKNITYYLTH

3D structure

PDB

6ijo Antenna arrangement and energy transfer pathways of a green algal photosystem-I-LHCI supercomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	9	T30 W31	T2 W3
BS02	CLA	9	F51 E70 R163	F23 E42 R130
BS03	CLA	9	G83 P94	G55 P66
BS04	CLA	9	Y104 L111 E115 M119	Y76 L83 E87 M91
BS05	CLA	9	T72 W76 M119 E123	T44 W48 M91 E95
BS06	CLA	9	R75 M78 F138 N140 N150 E158	R47 M50 F110 N112 N117 E125
BS07	CLA	9	K157 K160	K124 K127
BS08	CLA	9	K157 N161	K124 N128
BS09	CLA	9	G171 Q175 I199	G138 Q142 I166
BS10	CLA	9	H190 P194 F195	H157 P161 F162

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ijo, PDBe:6ijo, PDBj:6ijo
PDBsum	6ijo
PubMed	30850819
UniProt	A8ITV3

[Back to BioLiP]