Structure of PDB 5uq8 Chain 9

Receptor sequence
>5uq89 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB5uq8 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.
Chain9
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 M1 K2 R4 A5 S6 V7 R18 R19 H20 R22 P30 K31 K33 R35 Q36 G37 M1 K2 R4 A5 S6 V7 R18 R19 H20 R22 P30 K31 K33 R35 Q36 G37
BS02 ZN 9 C14 C27 H32 C14 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uq8, PDBe:5uq8, PDBj:5uq8
PDBsum5uq8
PubMed29456023
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]