Structure of PDB 4v19 Chain 9

Receptor sequence
>4v199 (length=38) Species: 9823 (Sus scrofa) [Search protein sequence]
FKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM
3D structure
PDB4v19 The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
Chain9
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 9 F63 K64 K66 G67 L69 K70 K71 R74 K80 R81 R82 G83 W85 F86 P93 K94 K96 R98 Q99 F1 K2 K4 G5 L7 K8 K9 R12 K18 R19 R20 G21 W23 F24 P31 K32 K34 R36 Q37
BS02 ZN 9 C89 H95 C27 H33
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 00:26:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v19', asym_id = '9', title = 'The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v19', asym_id='9', title='The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v19', asym_id = '9'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v19', asym_id='9')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>