Structure of PDB 8ugn Chain 8A

Receptor sequence

>8ugn8A (length=514) Species: 9823 (Sus scrofa)

MFVNRWLYSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGD
DQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNM
SFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSL
HLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLP
VLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPG
FGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTV
GGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLF
SGYTLNQAWAKIHFVIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTAW
NTISSMGSFISLTAVMLMIFIIWEAFASKREVSAVELTSTNLEWLHGCPP
PYHTFEEPTYINLK

3D structure

• PDB: 8ugn High-resolution in situ structures of mammalian respiratory supercomplexes.
• Chain: 8A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEA	8A	T31 S34 R38 Y54 V58 H61 A62 M65 M69 W126 Y371 V374 F377 H378 L381 S382 V386 M390 F425 R439	T31 S34 R38 Y54 V58 H61 A62 M65 M69 W126 Y371 V374 F377 H378 L381 S382 V386 M390 F425 R439
BS02	HEA	8A	W126 W236 V243 Y244 H290 H291 T316 G317 G352 G355 I356 A359 D364 H368 V373 H376 F377 V380 L381 R438	W126 W236 V243 Y244 H290 H291 T316 G317 G352 G355 I356 A359 D364 H368 V373 H376 F377 V380 L381 R438
BS03	CU	8A	H240 H290 H291	H240 H290 H291
BS04	MG	8A	H368 D369	H368 D369

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0015990 electron transport coupled proton transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:8ugn, PDBe:8ugn, PDBj:8ugn
• PDBsum: 8ugn
• PubMed: 38811722
• UniProt: O79876|COX1_PIG Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)