Structure of PDB 4wzo Chain 8A

Receptor sequence
>4wzo8A (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
3D structure
PDB4wzo Structural insights into the translational infidelity mechanism.
Chain8A
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8A P2 K3 K4 S12 M15 Q16 K17 R25 Y32 K34 S39 K40 K41 Y42 E61 S62 R63 P64 S66 K67 R68 K69 R70 R72 K87 R91 R92 N94 Y95 L98 K100 P1 K2 K3 S11 M14 Q15 K16 R24 Y31 K33 S38 K39 K40 Y41 E60 S61 R62 P63 S65 K66 R67 K68 R69 R71 K86 R90 R91 N93 Y94 L97 K99
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Mar 12 13:54:29 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4wzo', asym_id = '8A', title = 'Structural insights into the translational infidelity mechanism.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4wzo', asym_id='8A', title='Structural insights into the translational infidelity mechanism.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4wzo', asym_id = '8A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4wzo', asym_id='8A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>