Structure of PDB 5el5 Chain 88

Receptor sequence

>5el588 (length=141) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 88
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	88	R56 R60	R56 R60
BS02	rna	88	R5 R6 K8 Y9 R10 K11 Q12 Q13 R14 G15 R16 L17 T21 K22 G23 G24 Y26 F29 A40 W41 Q46 A49 R56 F65 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128 Q141	R5 R6 K8 Y9 R10 K11 Q12 Q13 R14 G15 R16 L17 T21 K22 G23 G24 Y26 F29 A40 W41 Q46 A49 R56 F65 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128 Q141
BS03	rna	88	R16 L17 K18 G19	R16 L17 K18 G19
BS04	MG	88	T21 P99 R101	T21 P99 R101

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el5, PDBe:5el5, PDBj:5el5
• PDBsum: 5el5
• PubMed: 26791911
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)