Structure of PDB 4wsd Chain 88

Receptor sequence

>4wsd88 (length=138) Species: 300852 (Thermus thermophilus HB8)

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNYVAVVKPGRVM
FEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

• PDB: 4wsd Structural insights into the translational infidelity mechanism.
• Chain: 88
• Resolution: 2.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	88	R51 R56	R51 R56
BS02	rna	88	P4 R5 R6 K8 Y9 R10 K11 Q12 Q13 R14 G15 R16 L17 K18 K22 G24 Y26 F29 A40 W41 Q46 A49 R56 R67 F69 D71 Y74 K76 K77 V81 R82 G84 K85 R101 R119 I120 H123 K124 P126 K128 Q141	P4 R5 R6 K8 Y9 R10 K11 Q12 Q13 R14 G15 R16 L17 K18 K22 G24 Y26 F29 A40 W41 Q46 A49 R56 R67 F69 D71 Y74 K76 K77 V81 R82 G84 K85 R98 R116 I117 H120 K121 P123 K125 Q138
BS03	rna	88	R16 L17 G19	R16 L17 G19

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
• PDBsum: 4wsd
• PubMed: 26037619
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)