Structure of PDB 3j77 Chain 88

Receptor sequence
>3j7788 (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSL
YTLVINDAGKAKKLIQSLPPTLKVNRL
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain88
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 88 A2 D19 K26 N28 K42 K44 R46 S48 S49 S50 L51 T53 G60 K61 K64 L78 A1 D18 K25 N27 K41 K43 R45 S47 S48 S49 L50 T52 G59 K60 K63 L77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP49167|RL38_YEAST Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]