Structure of PDB 3j77 Chain 85

Receptor sequence
>3j7785 (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain85
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 85 K74 Y75 K78 R86 R90 T93 F95 E96 K103 K106 K73 Y74 K77 R85 R89 T92 F94 E95 K102 K105
BS02 rna 85 Y7 R10 S40 P42 K45 K49 A52 L55 N59 R63 K78 K83 T85 R86 R89 Y6 R9 S39 P41 K44 K48 A51 L54 N58 R62 K77 K82 T84 R85 R88
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]