Structure of PDB 3j77 Chain 84

Receptor sequence

>3j7784 (length=112) Species: 4932 (Saccharomyces cerevisiae)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: 84
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	84	R4 V5 T6 F7 R8 R9 R10 P12 Y13 N14 K24 T25 P26 G27 K37 T40 R41 P42 K43 G45 Q52 G53 I54 S55 T56 P59 R60 Y62 S66 K67 T68 S73 Y76 G77 G78 R88 R91 I95	R3 V4 T5 F6 R7 R8 R9 P11 Y12 N13 K23 T24 P25 G26 K36 T39 R40 P41 K42 G44 Q51 G52 I53 S54 T55 P58 R59 Y61 S65 K66 T67 S72 Y75 G76 G77 R87 R90 I94

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)