Structure of PDB 3j77 Chain 83

Receptor sequence

>3j7783 (length=106) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	83	A2 E3 S4 H5 Y8 R18 S19 K20 R21 N23 P25 L45 G46 Y53 R54 S56 R60 S62 I64 R65 W68 K70 T72 R73 H75 N77 S78 R82 N87 N88 L89 P90 A91 K92 T93 G95 S97 R99	A1 E2 S3 H4 Y7 R17 S18 K19 R20 N22 P24 L44 G45 Y52 R53 S55 R59 S61 I63 R64 W67 K69 T71 R72 H74 N76 S77 R81 N86 N87 L88 P89 A90 K91 T92 G94 S96 R98

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P05744\|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)