Structure of PDB 4wra Chain 82

Receptor sequence

>4wra82 (length=122) Species: 300852 (Thermus thermophilus HB8)

EQYRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDAL
GHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDA
RVVERKKYGKHKARRAPQYSKR

3D structure

• PDB: 4wra Structural insights into the translational infidelity mechanism.
• Chain: 82
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	82	Q3 K11 E12 V14 R16 R20 Q38 G39 R66 G67 G68 G69 K70 S71 G72 Q73 R83 R93 K97 T103 R104 R107 V108 V109 E110 R111 K112 K113 Y114 H117 K118 A119 R120 R121 A122 Q124 Y125 S126 R128	Q2 K5 E6 V8 R10 R14 Q32 G33 R60 G61 G62 G63 K64 S65 G66 Q67 R77 R87 K91 T97 R98 R101 V102 V103 E104 R105 K106 K107 Y108 H111 K112 A113 R114 R115 A116 Q118 Y119 S120 R122
BS02	rna	82	K127 R128	K121 R122

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wra, PDBe:4wra, PDBj:4wra
• PDBsum: 4wra
• PubMed: 26037619
• UniProt: P80374|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)