Structure of PDB 3j77 Chain 82

Receptor sequence

>3j7782 (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	82	H21 H26 R27 N31 W32 R33 K34 K36 G37 I38 D39 R44 R45 F46 R47 G48 N49 I50 P53 K54 I55 G56 Y57 G58 S59 N60 K64 F65 L66 P68 A77 N78 K80 E95 I96 A97 H98 N99 I100 S101 A102 K103 N104 R125	H20 H25 R26 N30 W31 R32 K33 K35 G36 I37 D38 R43 R44 F45 R46 G47 N48 I49 P52 K53 I54 G55 Y56 G57 S58 N59 K63 F64 L65 P67 A76 N77 K79 E94 I95 A96 H97 N98 I99 S100 A101 K102 N103 R124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)