Structure of PDB 3j6x Chain 82

Receptor sequence

>3j6x82 (length=103) Species: 580240 (Saccharomyces cerevisiae W303)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QAL

3D structure

• PDB: 3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
• Chain: 82
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	82	V2 N3 V4 P5 K9 K13 K15 H20 Y28 A33 F36 Q38 R41 R42 K46 S48 G49 F50 G52 Q53 K55 P56 V57 F58 H59 K60 K61 A62 K63 T65 K66 K67 T79 R80 Q82 R87 C88 K89 H90 K97 K98 K100	V1 N2 V3 P4 K8 K12 K14 H19 Y27 A32 F35 Q37 R40 R41 K45 S47 G48 F49 G51 Q52 K54 P55 V56 F57 H58 K59 K60 A61 K62 T64 K65 K66 T78 R79 Q81 R86 C87 K88 H89 K96 K97 K99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
• PDBsum: 3j6x
• PubMed: 24927574
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)