Structure of PDB 3j77 Chain 80

Receptor sequence
>3j7780 (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY
YAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain80
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 80 L25 G26 Y27 K28 S29 T48 P49 V50 L51 R52 K53 L84 F85 V87 G88 L17 G18 Y19 K20 S21 T40 P41 V42 L43 R44 K45 L76 F77 V79 G80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0030627 pre-mRNA 5'-splice site binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP14120|RL30_YEAST Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]