Structure of PDB 8wi8 Chain 8

Receptor sequence
>8wi88 (length=62) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
PKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTVS
AADNSRINKLLN
3D structure
PDB8wi8 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chain8
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 P2 K3 K5 T6 H7 S8 K12 R13 R15 T17 G18 T19 R24 K26 A27 N28 R29 R30 H31 L32 L33 E34 H35 T38 R40 R42 R43 L44 R47 S51 D54 P1 K2 K4 T5 H6 S7 K11 R12 R14 T16 G17 T18 R23 K25 A26 N27 R28 R29 H30 L31 L32 E33 H34 T37 R39 R41 R42 L43 R46 S50 D53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi8, PDBe:8wi8, PDBj:8wi8
PDBsum8wi8
PubMed38245551
UniProtA0QYU7|RL35_MYCS2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]