Structure of PDB 8whx Chain 8

Receptor sequence

>8whx8 (length=63) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTVS
AADNSRINKLLNG

3D structure

• PDB: 8whx Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: 8
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	8	P2 K3 K5 T6 H7 S8 K12 R13 R15 T17 G18 T19 K21 R24 K26 A27 N28 R29 R30 H31 L32 L33 E34 H35 T38 R40 R42 R43 L44 R47 S51 A53 D54 R57	P1 K2 K4 T5 H6 S7 K11 R12 R14 T16 G17 T18 K20 R23 K25 A26 N27 R28 R29 H30 L31 L32 E33 H34 T37 R39 R41 R42 L43 R46 S50 A52 D53 R56

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8whx, PDBe:8whx, PDBj:8whx
• PDBsum: 8whx
• PubMed: 38245551
• UniProt: A0QYU7|RL35_MYCS2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)