Structure of PDB 8htu Chain 8

Receptor sequence

>8htu8 (length=204) Species: 3218 (Physcomitrium patens) [Search protein sequence]

DRPLWLPGSEAPKWLDGSLPGDYGFDPLDLAAEPGRLNWMVQAELVHCRW
AMLGAAGIFIPELLTKIGILNTPSWYKAGDATYFADQGTLFIVELLLMAW
AESRRWADIARPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSED
KLKEIRTKEVKNGRLAMLAVLGAFVQANVTHVGPIDNLFAHLADPYHTTI
LQSL

3D structure

PDB

8htu Structural insights into the assembly and energy transfer of the Lhcb9-dependent photosystem I from moss Physcomitrium patens.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	8	W163 S166 R167	W100 S103 R104
BS02	CLA	8	L67 W68 L69 P70 Y86 F88	L4 W5 L6 P7 Y23 F25
BS03	CLA	8	L78 G84 D85 Y86 L93 M103 V104 E107 R227	L15 G21 D22 Y23 L30 M40 V41 E44 R164
BS04	CLA	8	W102 M103 H110	W39 M40 H47
BS05	CLA	8	W113 L116 Y146	W50 L53 Y83
BS06	CHL	8	Y146 F147 L153 E157	Y83 F84 L90 E94
BS07	CHL	8	G142 E157 F237	G79 E94 F174
BS08	CHL	8	R112 W113 R167 R168 D171 G195 P197 F202	R49 W50 R104 R105 D108 G132 P134 F139
BS09	CLA	8	W102 A106 V109 H110 L158 M161 E165 R168 W169	W39 A43 V46 H47 L95 M98 E102 R105 W106
BS10	CLA	8	R112 M115 Y196 P197 W207 G208 I218 E222	R49 M52 Y133 P134 W144 G145 I155 E159
BS11	CLA	8	K221 K224	K158 K161
BS12	CLA	8	G235 Q239 T243 N250 H254 T262 I263 S266	G172 Q176 T180 N187 H191 T199 I200 S203
BS13	CLA	8	H254 P258	H191 P195
BS14	CHL	8	W163 N179 T180 D181 P182 F184 N187 W201	W100 N116 T117 D118 P119 F121 N124 W138

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009765	photosynthesis, light harvesting
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8htu, PDBe:8htu, PDBj:8htu
PDBsum	8htu
PubMed	37474782
UniProt	A0A2K1K0E4

[Back to BioLiP]