Structure of PDB 8cdr Chain 8

Receptor sequence
>8cdr8 (length=36) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KHKKVKLAVLRECSNPTCGAGVFLANHKDRLYCGKC
3D structure
PDB8cdr mRNA reading frame maintenance during eukaryotic ribosome translocation
Chain8
Resolution2.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 K94 H95 K97 G129 F131 A133 H135 R138 Y140 K143 C144 K1 H2 K4 G21 F23 A25 H27 R30 Y32 K35 C36
BS02 ZN 8 C141 K143 C33 K35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002109 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S)
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
GO:0042254 ribosome biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cdr, PDBe:8cdr, PDBj:8cdr
PDBsum8cdr
PubMed38030725
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]