Structure of PDB 7unv Chain 8

Receptor sequence
>7unv8 (length=38) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MKVRASVKKLCRNCKIIRRDGIVRVICSAEPRHKQRQG
3D structure
PDB7unv Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chain8
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 M1 R4 A5 S6 V7 L10 R19 D20 R24 R32 K34 R36 G38 M1 R4 A5 S6 V7 L10 R19 D20 R24 R32 K34 R36 G38
BS02 ZN 8 C27 H33 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unv, PDBe:7unv, PDBj:7unv
PDBsum7unv
PubMed
UniProtQ9HWF6|RL361_PSEAE Large ribosomal subunit protein bL36A (Gene Name=rpmJ)

[Back to BioLiP]