Structure of PDB 7ss9 Chain 8

Receptor sequence
>7ss98 (length=286) Species: 1268978 (Escherichia coli 113303) [Search protein sequence]
PVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGE
LHLDIIVDRMKREFNVEANVGKPQVAYRETIRQKVTDVEGKHAKQSGGRG
QYGHVVIDMYPLEPGSNPKGYEFINDIKGGVIPGEYIPAVDKGIQEQLKA
GPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIAFKEGFKKAKPVLL
EPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPLSEM
FGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVI
3D structure
PDB7ss9 Time-resolved cryo-EM visualizes ribosomal translocation with EF-G and GTP.
Chain8
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 K507 Q508 S509 G510 L591 K94 Q95 S96 G97 L178
BS02 rna 8 K507 E626 T628 G629 I632 G633 L642 R671 S672 K675 R677 K94 E213 T215 G216 I219 G220 L229 R258 S259 K262 R264
BS03 rna 8 G510 R512 S589 E590 G97 R99 S176 E177
BS04 rna 8 K504 Q508 D587 K91 Q95 D174
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 14:37:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ss9', asym_id = '8', title = 'Time-resolved cryo-EM visualizes ribosomal translocation with EF-G and GTP.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ss9', asym_id='8', title='Time-resolved cryo-EM visualizes ribosomal translocation with EF-G and GTP.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003746,0003924,0005525,0006414', uniprot = '', pdbid = '7ss9', asym_id = '8'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003746,0003924,0005525,0006414', uniprot='', pdbid='7ss9', asym_id='8')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>