Structure of PDB 7q0r Chain 8

Receptor sequence

>7q0r8 (length=121) Species: 237561 (Candida albicans SC5314)

KALKVRTSTTFRLPKTLKLTRSPKYQRKSVPHYNRLDAHKIIVAPIATET
AMKKVEDGNTLVFQVDIKSNKHQIKSAVKELYDVDALYVNTLIRPNGTKK
AYIRLTSDYDALDIANRIGYI

3D structure

• PDB: 7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: 8
• Resolution: 2.67 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	8	L24 T30 T31 R33 L34 P35 K36 L40 R42 S43 P44 K45 R48 T69 K75 N91 K92 H93 Y109 N111 T112 L113 I114 P116 K120 K121 Y123 R125	L3 T9 T10 R12 L13 P14 K15 L19 R21 S22 P23 K24 R27 T48 K54 N70 K71 H72 Y88 N90 T91 L92 I93 P95 K99 K100 Y102 R104
BS02	rna	8	L24 R27 P35 T37 R42 K49 H53 Y54 N55 R56 K61 I88 K89 H93 Q94	L3 R6 P14 T16 R21 K28 H32 Y33 N34 R35 K40 I67 K68 H72 Q73

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
• PDBsum: 7q0r
• PubMed: 35613268
• UniProt: A0A1D8PPS1|RL25_CANAL Large ribosomal subunit protein uL23 (Gene Name=RPL25)