Structure of PDB 7po0 Chain 8

Receptor sequence
>7po08 (length=191) Species: 9606 (Homo sapiens) [Search protein sequence]
KTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNT
STEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHD
LDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIA
TFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDT
3D structure
PDB7po0 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain8
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 K72 S76 N77 R115 G133 L137 R140 R144 K159 E160 S164 N166 G168 H170 D171 T174 K175 Q178 W182 K1 S5 N6 R44 G62 L66 R69 R73 K88 E89 S93 N95 G97 H99 D100 T103 K104 Q107 W111
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 22:46:30 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7po0', asym_id = '8', title = 'Mechanism of mitoribosomal small subunit biogenesis and preinitiation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7po0', asym_id='8', title='Mechanism of mitoribosomal small subunit biogenesis and preinitiation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003743,0006413', uniprot = '', pdbid = '7po0', asym_id = '8'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003743,0006413', uniprot='', pdbid='7po0', asym_id='8')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>