Structure of PDB 7p7s Chain 8

Receptor sequence
>7p7s8 (length=38) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
MKVRPSVKPMCEHCKVIRRKGRVMVICPANPKHKQRQG
3D structure
PDB7p7s Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chain8
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 M1 K2 R4 P5 S6 V7 K8 M10 R19 K20 R22 P31 K32 K34 R36 Q37 G38 M1 K2 R4 P5 S6 V7 K8 M10 R19 K20 R22 P31 K32 K34 R36 Q37 G38
BS02 ZN 8 C11 C27 H33 C11 C27 H33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7s, PDBe:7p7s, PDBj:7p7s
PDBsum7p7s
PubMed35387982
UniProtA0A1B4XKT9

[Back to BioLiP]