Structure of PDB 7p2e Chain 8

Receptor sequence
>7p2e8 (length=191) Species: 9606 (Homo sapiens) [Search protein sequence]
KTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNT
STEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHD
LDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIA
TFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDT
3D structure
PDB7p2e Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
Chain8
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 K72 S76 N77 R115 G133 I136 L137 R140 R144 K159 E160 S164 N166 G168 H170 D171 T174 K175 Q178 W182 K1 S5 N6 R44 G62 I65 L66 R69 R73 K88 E89 S93 N95 G97 H99 D100 T103 K104 Q107 W111
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
GO:0043022 ribosome binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0032790 ribosome disassembly
GO:0070124 mitochondrial translational initiation
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p2e, PDBe:7p2e, PDBj:7p2e
PDBsum7p2e
PubMed36480258
UniProtQ9H2K0|IF3M_HUMAN Translation initiation factor IF-3, mitochondrial (Gene Name=MTIF3)

[Back to BioLiP]