Structure of PDB 7oi8 Chain 8

Receptor sequence
>7oi88 (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
IPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKME
RDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPP
3D structure
PDB7oi8 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Chain8
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 F88 K119 L123 K125 Q126 R129 F6 K37 L41 K43 Q44 R47
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009653 anatomical structure morphogenesis
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi8, PDBe:7oi8, PDBj:7oi8
PDBsum7oi8
PubMed34315873
UniProtQ9NQ50|RM40_HUMAN Large ribosomal subunit protein mL40 (Gene Name=MRPL40)

[Back to BioLiP]