Structure of PDB 7jt2 Chain 8

Receptor sequence

>7jt28 (length=132) Species: 83333 (Escherichia coli K-12)

IVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEY
YKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTE
KKARRPTRPTRASKERRLASKAQKSSVKAMRG

3D structure

• PDB: 7jt2 ArfB can displace mRNA to rescue stalled ribosomes
• Chain: 8
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.1.29: peptidyl-tRNA hydrolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	8	T108 R117 R118 K125	T107 R116 R117 K124
BS02	rna	8	I20 R21 Q23 A25 G26 G27 Q28 V30 N31 K32 T33 S34 T35 L39 H62 L63 S66 D67 E76 Y77 R78 Q80 R90 K102 K103 A104 R105 R106	I19 R20 Q22 A24 G25 G26 Q27 V29 N30 K31 T32 S33 T34 L38 H61 L62 S65 D66 E75 Y76 R77 Q79 R89 K101 K102 A103 R104 R105
BS03	rna	8	G26 R78 L82	G25 R77 L81
BS04	rna	8	P107 R109 T111 R112	P106 R108 T110 R111

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0004045 aminoacyl-tRNA hydrolase activity
• GO:0016787 hydrolase activity
• GO:0043022 ribosome binding

Biological Process

• GO:0006415 translational termination
• GO:0006417 regulation of translation
• GO:0072344 rescue of stalled ribosome

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7jt2, PDBe:7jt2, PDBj:7jt2
• PDBsum: 7jt2
• PubMed: 33144582
• UniProt: P40711|ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB (Gene Name=arfB)