Structure of PDB 7dgs Chain 8

Receptor sequence

>7dgs8 (length=427) Species: 9913 (Bos taurus)

FGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVK
TSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREII
RHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGL
IGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPA
DVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGH
VNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSV
CETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQ
CTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGA
AWPVQGLIRHFRPELEERMQQFAQQHQ

3D structure

• PDB: 7dgs A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
• Chain: 8
• Resolution: 7.8 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	8	R152 Y163 R174 Y177 E178 K184 F196 R199	R121 Y132 R143 Y146 E147 K153 F165 R168
BS02	FMN	8	G89 K98 N116 D118 E119 G120 C206 G207 E208 V242	G58 K67 N85 D87 E88 G89 C175 G176 E177 V211
BS03	SF4	8	Y204 C379 C382 C385 T423 I424 C425 L427	Y173 C348 C351 C354 T392 I393 C394 L396

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7dgs, PDBe:7dgs, PDBj:7dgs
• PDBsum: 7dgs
• PubMed: 34913730
• UniProt: P25708|NDUV1_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Gene Name=NDUFV1)