Structure of PDB 6y50 Chain 8 |
>6y508 (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFK RKYLQGKRGIEKPPFELPDFIKRDIDYQKLHDAFFKWQTKPKLTIHGDLY YEGKEFE |
|
PDB | 6y50 Molecular architecture of the human 17S U2 snRNP. |
Chain | 8 |
Resolution | 4.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
8 |
H478 C505 |
H21 C48 |
|
|
|
|