Structure of PDB 6vpv Chain 8

Receptor sequence
>6vpv8 (length=39) Species: 2676140 (Cyanobacterium aponinum 0216) [Search protein sequence]
KGLTTFLSTAPVLITALLVFTAGLLIEFNRFYPDLLFHP
3D structure
PDB6vpv The structure of photosystem I from a high-light tolerant Cyanobacteria.
Chain8
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 8 T16 L19 T15 L18
BS02 CLA 8 F29 N30 D35 L36 L37 F28 N29 D34 L35 L36
BS03 CLA 8 L18 T22 L17 T21
BS04 CLA 8 F7 A11 P12 F6 A10 P11
BS05 CLA 8 F21 G24 L25 E28 R31 F32 F20 G23 L24 E27 R30 F31
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vpv, PDBe:6vpv, PDBj:6vpv
PDBsum6vpv
PubMed34435952
UniProtK9Z1F7

[Back to BioLiP]