Structure of PDB 6ogf Chain 8

Receptor sequence

>6ogf8 (length=361) Species: 562 (Escherichia coli)

INPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERA
QALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAEL
DALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYL
RWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVR
KSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQH
VNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKK
NAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSL
DQFIEASLKAG

3D structure

• PDB: 6ogf Extensive ribosome and RF2 rearrangements during translation termination.
• Chain: 8
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	8	G135 S136 R150 R200 R212 R213 W319 R332 K334 R343	G132 S133 R147 R197 R209 R210 W316 R329 K331 R340
BS02	rna	8	W47 P50 E51 Q54 R60 Q133 R240 Y244 R245 S247 G248 A249 G250 G251 Q252 H253 V254 N255 R256 S259 R262 Q280 E311 S315	W44 P47 E48 Q51 R57 Q130 R237 Y241 R242 S244 G245 A246 G247 G248 Q249 H250 V251 N252 R253 S256 R259 Q277 E308 S312
BS03	rna	8	E172 V173	E169 V170
BS04	rna	8	G137 G138 T139 E140 R212 R213 H214 T215	G134 G135 T136 E137 R209 R210 H211 T212

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination
• GO:0075523 viral translational frameshifting

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6ogf, PDBe:6ogf, PDBj:6ogf
• PDBsum: 6ogf
• PubMed: 31513010
• UniProt: P07012|RF2_ECOLI Peptide chain release factor RF2 (Gene Name=prfB)