Structure of PDB 6ff7 Chain 8 |
>6ff78 (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] |
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFK RKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKV RPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRL |
|
PDB | 6ff7 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex. |
Chain | 8 |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
8 |
T481 C505 |
T24 C48 |
|
|
|
|