Structure of PDB 5tzs Chain 8

Receptor sequence
>5tzs8 (length=173) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKAKIESSVESQFSAGRLYACISSRPGQSG
RCDGYILEGEELAFYLRRLTAKK
3D structure
PDB5tzs Architecture of the yeast small subunit processome.
Chain8
Resolution5.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 8 S4 R5 D6 S7 H9 K10 R11 S12 A13 T14 G15 A16 K17 F21 F27 R31 P33 A34 T48 R49 N64 G71 I72 S73 S86 N87 K98 G174 S3 R4 D5 S6 H8 K9 R10 S11 A12 T13 G14 A15 K16 F20 F26 R30 P32 A33 T47 R48 N63 G70 I71 S72 S85 N86 K97 G147
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tzs, PDBe:5tzs, PDBj:5tzs
PDBsum5tzs
PubMed27980088
UniProtP0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)

[Back to BioLiP]