Structure of PDB 5oy0 Chain 8

Receptor sequence
>5oy08 (length=79) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASK
KTFGLPELLATMSFGHILGAGMVLGLASS
3D structure
PDB5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
Chain8
Resolution2.501 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 8 P64 L67 A68 P56 L59 A60
BS02 CLA 8 A40 Q42 A32 Q34
BS03 CLA 8 L76 G79 G83 S87 L68 G71 G75 S79
BS04 CLA 8 V22 M26 N30 M70 H74 V14 M18 N22 M62 H66
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
PDBsum5oy0
PubMed29414678
UniProtP74564|PSAK2_SYNY3 Photosystem I reaction center subunit PsaK 2 (Gene Name=psaK2)

[Back to BioLiP]