Structure of PDB 8snb Chain 7U |
>8snb7U (length=93) Species: 7668 (Strongylocentrotus purpuratus) [Search protein sequence] |
VNETITDLVKRERLTSTYVRQCPGYAGYRPRSPLRIPMENLNEPNLRMTT TMKASYRPLMFPLINMDHFPHMGPMSRTVTLTYPCNPFNKVEK |
|
PDB | 8snb Structural specializations of the sperm tail. |
Chain | 7U |
Resolution | 3.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
7U |
R175 F186 |
R77 F88 |
|
|
|