Structure of PDB 4wt1 Chain 7A

Receptor sequence
>4wt17A (length=84) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEA
3D structure
PDB4wt1 Structural insights into the translational infidelity mechanism.
Chain7A
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 7A M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 Y17 R18 D23 R25 K27 R28 K31 I33 Y38 P41 R42 V62 G63 T67 D68 T69 R72 R75 F80 R81 Q82 M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 Y17 R18 D23 R25 K27 R28 K31 I33 Y38 P41 R42 V62 G63 T67 D68 T69 R72 R75 F80 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wt1, PDBe:4wt1, PDBj:4wt1
PDBsum4wt1
PubMed26037619
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]