Structure of PDB 5e81 Chain 79

Receptor sequence
>5e8179 (length=57) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRYRALVDPNKIYTIDEVHAKLGIDPRRSDQNNDKTGAIHAHKPEGAKGT
FLRSVRI
3D structure
PDB5e81 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Chain79
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 79 R52 R53 R27 R28
BS02 rna 79 K5 R6 Y7 E42 H44 K46 D166 K167 T168 H172 K205 S221 K1 R2 Y3 E17 H19 K21 D34 K35 T36 H40 K48 S54
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e81, PDBe:5e81, PDBj:5e81
PDBsum5e81
PubMed26791911
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]