Structure of PDB 3j77 Chain 79

Receptor sequence
>3j7779 (length=58) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain79
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 79 A2 K3 S4 K5 N6 H7 T8 A9 H10 N11 Q12 R14 H17 R18 N19 K23 Y29 L32 P37 K38 R41 N42 H43 H45 A46 A1 K2 S3 K4 N5 H6 T7 A8 H9 N10 Q11 R13 H16 R17 N18 K22 Y28 L31 P36 K37 R40 N41 H42 H44 A45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)

[Back to BioLiP]