Structure of PDB 3j6y Chain 79

Receptor sequence
>3j6y79 (length=50) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain79
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 79 A2 A3 Q4 K5 K10 M13 P22 Y37 A39 W44 R45 K48 M49 A1 A2 Q3 K4 K9 M12 P21 Y36 A38 W43 R44 K47 M48
BS02 rna 79 S6 F7 Q11 K12 K15 K18 L23 W26 L29 R30 T31 S5 F6 Q10 K11 K14 K17 L22 W25 L28 R29 T30
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]