Structure of PDB 3j77 Chain 78

Receptor sequence

>3j7778 (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPG
YFGKVGMRYFHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPV
IDTLAAGYGKILGKGRIPNVPVIVKARFVSKLAEEKIRAAGGVVELIA

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	78	P2 S3 R4 F5 T6 K7 T8 R9 R12 V15 S16 A17 G18 K19 G20 R21 I22 G23 K24 H25 R26 K27 P29 R32 G33 M34 H40 H41 I43 N44 F53 G54 K55 G57 M58 R59 Y60 F61 H62 K63 Q64 H67 N74 K111 L113 G114 K115 G116 R117 K132 L133	P1 S2 R3 F4 T5 K6 T7 R8 R11 V14 S15 A16 G17 K18 G19 R20 I21 G22 K23 H24 R25 K26 P28 R31 G32 M33 H39 H40 I42 N43 F52 G53 K54 G56 M57 R58 Y59 F60 H61 K62 Q63 H66 N73 K110 L112 G113 K114 G115 R116 K131 L132

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P02406\|RL28_YEAST Large ribosomal subunit protein uL15 (Gene Name=RPL28)

[Back to BioLiP]