Structure of PDB 3j77 Chain 77

Receptor sequence
>3j7777 (length=135) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPL
KVTKKHGAKKVAKRTKIKPFIKVVNYNHLLPTRYTLDVEAFKSVVSTETF
EQPSQREEAKKVVKKAFEERHQAGKNQWFFSKLRF
3D structure
PDB3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
Chain77
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 77 R15 G16 R17 F38 R48 L51 K55 K56 G58 A59 K61 K69 K73 K112 K133 R135 F136 R14 G15 R16 F37 R47 L50 K54 K55 G57 A58 K60 K68 K72 K111 K132 R134 F135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum3j77
PubMed25043550
UniProtP0C2H6|RL27A_YEAST Large ribosomal subunit protein eL27A (Gene Name=RPL27A)

[Back to BioLiP]