Structure of PDB 3j6y Chain 77

Receptor sequence

>3j6y77 (length=87) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

PDB

3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	77	G2 K3 T5 P6 F8 K10 R11 H12 N13 K14 H16 R24 Q30 S35 K43 T44 R45 Y47 N48 W49 R55 R56	G1 K2 T4 P5 F7 K9 R10 H11 N12 K13 H15 R23 Q29 S34 K42 T43 R44 Y46 N47 W48 R54 R55
BS02	rna	77	C22 K32 Y39 T59 G60 T61 G62 R63 M64 R65 Y66 L67 R72 F74 N76 Q79 T80 G81 S82 A83 K85 A86 A88	C21 K31 Y38 T58 G59 T60 G61 R62 M63 R64 Y65 L66 R71 F73 N75 Q78 T79 G80 S81 A82 K84 A85 A87

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum	3j6y
PubMed	24927574
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)