Structure of PDB 5el6 Chain 75

Receptor sequence

>5el675 (length=133) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDQDRAAERAAKE

3D structure

PDB

5el6 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	75	R39 R41 D107 R108 R111 R118 K119 D122	R39 R41 D107 R108 R111 R118 K119 D122
BS02	rna	75	N2 R3 G4 A5 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 R112 K113 R115 K119	N2 R3 G4 A5 R23 R51 R53 R54 N55 N58 T60 I75 R93 R95 R96 A97 K98 Y100 F101 R112 K113 R115 K119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5el6, PDBe:5el6, PDBj:5el6
PDBsum	5el6
PubMed	26791911
UniProt	P60490\|RL19_THET8 Large ribosomal subunit protein bL19 (Gene Name=rplS)