Structure of PDB 3j6x Chain 74

Receptor sequence

>3j6x74 (length=112) Species: 580240 (Saccharomyces cerevisiae W303)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
• Chain: 74
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	74	A2 R4 T6 F7 R8 R9 R10 P12 Y13 N14 T15 R16 K21 K24 T25 P26 G27 R31 K37 T40 R41 P42 K43 Q52 G53 T56 R58 P59 R60 Q61 T64 K67 T68 T71 S73 R74 Y76 N83 R91 I95 Q98 K99	A1 R3 T5 F6 R7 R8 R9 P11 Y12 N13 T14 R15 K20 K23 T24 P25 G26 R30 K36 T39 R40 P41 K42 Q51 G52 T55 R57 P58 R59 Q60 T63 K66 T67 T70 S72 R73 Y75 N82 R90 I94 Q97 K98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
• PDBsum: 3j6x
• PubMed: 24927574
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)