Structure of PDB 5el5 Chain 71

Receptor sequence
>5el571 (length=135) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGFRNDKTGAIHAPVGKASFPPEKLADNIRAFI
RALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
3D structure
PDB5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Chain71
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 71 R52 R53 R52 R53
BS02 rna 71 H3 K5 R6 Y7 K36 F37 T40 E42 H44 K46 D166 K167 T168 A170 H172 P174 K205 G206 R210 S211 Y213 T215 T217 M218 G219 S221 H3 K5 R6 Y7 K36 F37 T40 E42 H44 K46 D73 K74 T75 A77 H79 P81 K112 G113 R117 S118 Y120 T122 T124 M125 G126 S128
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5el5, PDBe:5el5, PDBj:5el5
PDBsum5el5
PubMed26791911
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]