Structure of PDB 3j77 Chain 71

Receptor sequence

>3j7771 (length=159) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	71	K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 R17 F19 G23 K43 G46 Q49 K50 G51 H54 K55 Y57 Q58 T61 T68 K69 S71 K78 L85 R88 L89 N90 R92 K100 C101 E104 F105 R108 R116 Q127 L128 K129 R130 P132	K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 R16 F18 G22 K42 G45 Q48 K49 G50 H53 K54 Y56 Q57 T60 T67 K68 S70 K77 L84 R87 L88 N89 R91 K99 C100 E103 F104 R107 R115 Q126 L127 K128 R129 P131
BS02	rna	71	R20 H26 S28	R19 H25 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]