Structure of PDB 3j77 Chain 70

Receptor sequence

>3j7770 (length=172) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	70	M1 A2 N65 E66 H68 K71 R84 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 R115 K146 P153 H154 R155 Q157 K161 Y165 R167 P168 S169 T170 F171	M1 A2 N65 E66 H68 K71 R84 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 R115 K146 P153 H154 R155 Q157 K161 Y165 R167 P168 S169 T170 F171
BS02	rna	70	S39 Y43 Q46 H49 K50 V51 K52 A54 R84 R117 R119	S39 Y43 Q46 H49 K50 V51 K52 A54 R84 R117 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]